They do NOT say why they are being held, and I have set and re-set the acceptance to "accept immediately" until I am blue in the face and it makes not one iota of difference. Anne -----Original Message----- From: Pat Asher [mailto:pasher@ee.net] Sent: 31 October 2018 22:20 To: Listowners list for Rootsweb list admins and moderators <listowners@rootsweb.com> Cc: Angus Administrator <angus.admin@btinternet.com> Subject: Re: [LO] Subscriber messages are still being held for approval At 05:51 PM 10/31/2018, Angus Administrator via LISTOWNERS wrote: >At long last my ANGUS list has received some posts from members. > >But in spite of me having set it to accept immediately posts from >subscribers, it is still holding them for my approval. > >This is OK when there is a just a handful of posts, but will it be >sorted out soon please? WHY are they being held for approval? The notices sent to you, the admin, specify the reason. That is what you have to sort out, possibly adjusting your list settings. Pat A.
Yes they tell you exactly why they are being held. You're probably not looking in the right place. All you have to do is scroll down in the notification past the header lines till you get near the bottom. Near the bottom is line that starts X-Mailman-Rule-Hits: Whatever follows that is the reason the message was held. Gene At 06:37 PM 10/31/2018, Angus Administrator via LISTOWNERS wrote: >They do NOT say why they are being held, and I have set and re-set the >acceptance to "accept immediately" until I am blue in the face and it makes >not one iota of difference. > >Anne > >-----Original Message----- >From: Pat Asher [mailto:pasher@ee.net] >Sent: 31 October 2018 22:20 >To: Listowners list for Rootsweb list admins and moderators ><listowners@rootsweb.com> >Cc: Angus Administrator <angus.admin@btinternet.com> >Subject: Re: [LO] Subscriber messages are still being held for approval > >At 05:51 PM 10/31/2018, Angus Administrator via LISTOWNERS wrote: >>At long last my ANGUS list has received some posts from members. >> >>But in spite of me having set it to accept immediately posts from >>subscribers, it is still holding them for my approval. >> >>This is OK when there is a just a handful of posts, but will it be >>sorted out soon please? > >WHY are they being held for approval? The notices sent to you, the admin, >specify the reason. That is what you have to sort out, possibly adjusting >your list settings. > >Pat A. > >_______________________________________________ >Email preferences: http://bit.ly/rootswebpref >Unsubscribe https://lists.rootsweb.com/postorius/lists/listowners@rootsweb.com >Privacy Statement: https://ancstry.me/2JWBOdY Terms and Conditions: https://ancstry.me/2HDBym9 >Rootsweb Blog: http://rootsweb.blog >RootsWeb is funded and supported by Ancestry.com and our loyal RootsWeb community > >--- >This email has been checked for viruses by AVG. >https://www.avg.com
No, they don't. They always say, "The message is being held because: N/A". N/A is NOT a reason. Anne -----Original Message----- From: Gene Phillips [mailto:gnphllps@comcast.net] Sent: 01 November 2018 01:05 To: Listowners list for Rootsweb list admins and moderators <listowners@rootsweb.com> Subject: [LO] Re: Subscriber messages are still being held for approval Yes they tell you exactly why they are being held. You're probably not looking in the right place. All you have to do is scroll down in the notification past the header lines till you get near the bottom. Near the bottom is line that starts X-Mailman-Rule-Hits: Whatever follows that is the reason the message was held. Gene At 06:37 PM 10/31/2018, Angus Administrator via LISTOWNERS wrote: >They do NOT say why they are being held, and I have set and re-set the >acceptance to "accept immediately" until I am blue in the face and it makes >not one iota of difference. > >Anne > >-----Original Message----- >From: Pat Asher [mailto:pasher@ee.net] >Sent: 31 October 2018 22:20 >To: Listowners list for Rootsweb list admins and moderators ><listowners@rootsweb.com> >Cc: Angus Administrator <angus.admin@btinternet.com> >Subject: Re: [LO] Subscriber messages are still being held for approval > >At 05:51 PM 10/31/2018, Angus Administrator via LISTOWNERS wrote: >>At long last my ANGUS list has received some posts from members. >> >>But in spite of me having set it to accept immediately posts from >>subscribers, it is still holding them for my approval. >> >>This is OK when there is a just a handful of posts, but will it be >>sorted out soon please? > >WHY are they being held for approval? The notices sent to you, the admin, >specify the reason. That is what you have to sort out, possibly adjusting >your list settings. > >Pat A.
It doesn't say that where I told you to look. Ignore what it says at the top of the message and scroll down and look where I told you to look. Or forward one of the notifications to this list so I can look. Gene At 07:18 AM 11/1/2018, Angus Administrator via LISTOWNERS wrote: >No, they don't. > >They always say, "The message is being held because: N/A". N/A is NOT a >reason. > >Anne > >-----Original Message----- >From: Gene Phillips [mailto:gnphllps@comcast.net] >Sent: 01 November 2018 01:05 >To: Listowners list for Rootsweb list admins and moderators ><listowners@rootsweb.com> >Subject: [LO] Re: Subscriber messages are still being held for approval > >Yes they tell you exactly why they are being held. You're probably not >looking in the right place. > >All you have to do is scroll down in the notification past the header lines >till you get near the bottom. Near the bottom is line that starts > >X-Mailman-Rule-Hits: > >Whatever follows that is the reason the message was held. > >Gene > > >At 06:37 PM 10/31/2018, Angus Administrator via LISTOWNERS wrote: >>They do NOT say why they are being held, and I have set and re-set the >>acceptance to "accept immediately" until I am blue in the face and it makes >>not one iota of difference. >> >>Anne >> >>-----Original Message----- >>From: Pat Asher [mailto:pasher@ee.net] >>Sent: 31 October 2018 22:20 >>To: Listowners list for Rootsweb list admins and moderators >><listowners@rootsweb.com> >>Cc: Angus Administrator <angus.admin@btinternet.com> >>Subject: Re: [LO] Subscriber messages are still being held for approval >> >>At 05:51 PM 10/31/2018, Angus Administrator via LISTOWNERS wrote: >>>At long last my ANGUS list has received some posts from members. >>> >>>But in spite of me having set it to accept immediately posts from >>>subscribers, it is still holding them for my approval. >>> >>>This is OK when there is a just a handful of posts, but will it be >>>sorted out soon please? >> >>WHY are they being held for approval? The notices sent to you, the admin, >>specify the reason. That is what you have to sort out, possibly adjusting >>your list settings. >> >>Pat A. > > >_______________________________________________ >Email preferences: http://bit.ly/rootswebpref >Unsubscribe https://lists.rootsweb.com/postorius/lists/listowners@rootsweb.com >Privacy Statement: https://ancstry.me/2JWBOdY Terms and Conditions: https://ancstry.me/2HDBym9 >Rootsweb Blog: http://rootsweb.blog >RootsWeb is funded and supported by Ancestry.com and our loyal RootsWeb community > >--- >This email has been checked for viruses by AVG. >https://www.avg.com
I scrolled down until everything had disappeared off the top of the page and found no additional information. I have tried right-clicking and left-clicking on every part of the message in the hope of finding some hidden details, but to no avail. In any case, the problem is not what the reason for holding them is or isn't. The problem is that the system is not doing what it is supposed to. It even holds my own posts for my approval, even though I have set the List default to accept immediately AND set my own address to accept immediately. Anne -----Original Message----- From: Gene Phillips [mailto:gnphllps@comcast.net] Sent: 01 November 2018 13:12 To: Listowners list for Rootsweb list admins and moderators <listowners@rootsweb.com> Subject: [LO] Re: Subscriber messages are still being held for approval It doesn't say that where I told you to look. Ignore what it says at the top of the message and scroll down and look where I told you to look. Or forward one of the notifications to this list so I can look. Gene At 07:18 AM 11/1/2018, Angus Administrator via LISTOWNERS wrote: >No, they don't. > >They always say, "The message is being held because: N/A". N/A is NOT a >reason. > >Anne > >-----Original Message----- >From: Gene Phillips [mailto:gnphllps@comcast.net] >Sent: 01 November 2018 01:05 >To: Listowners list for Rootsweb list admins and moderators ><listowners@rootsweb.com> >Subject: [LO] Re: Subscriber messages are still being held for approval > >Yes they tell you exactly why they are being held. You're probably not >looking in the right place. > >All you have to do is scroll down in the notification past the header >lines till you get near the bottom. Near the bottom is line that starts > >X-Mailman-Rule-Hits: > >Whatever follows that is the reason the message was held. > >Gene > > >At 06:37 PM 10/31/2018, Angus Administrator via LISTOWNERS wrote: >>They do NOT say why they are being held, and I have set and re-set the >>acceptance to "accept immediately" until I am blue in the face and it >>makes not one iota of difference. >> >>Anne >> >>-----Original Message----- >>From: Pat Asher [mailto:pasher@ee.net] >>Sent: 31 October 2018 22:20 >>To: Listowners list for Rootsweb list admins and moderators >><listowners@rootsweb.com> >>Cc: Angus Administrator <angus.admin@btinternet.com> >>Subject: Re: [LO] Subscriber messages are still being held for >>approval >> >>At 05:51 PM 10/31/2018, Angus Administrator via LISTOWNERS wrote: >>>At long last my ANGUS list has received some posts from members. >>> >>>But in spite of me having set it to accept immediately posts from >>>subscribers, it is still holding them for my approval. >>> >>>This is OK when there is a just a handful of posts, but will it be >>>sorted out soon please? >> >>WHY are they being held for approval? The notices sent to you, the >>admin, specify the reason. That is what you have to sort out, possibly >>adjusting your list settings. >> >>Pat A. > > >_______________________________________________ >Email preferences: http://bit.ly/rootswebpref Unsubscribe >https://lists.rootsweb.com/postorius/lists/listowners@rootsweb.com >Privacy Statement: https://ancstry.me/2JWBOdY Terms and Conditions: >https://ancstry.me/2HDBym9 Rootsweb Blog: http://rootsweb.blog RootsWeb >is funded and supported by Ancestry.com and our loyal RootsWeb >community > >--- >This email has been checked for viruses by AVG. >https://www.avg.com _______________________________________________ Email preferences: http://bit.ly/rootswebpref Unsubscribe https://lists.rootsweb.com/postorius/lists/listowners@rootsweb.com Privacy Statement: https://ancstry.me/2JWBOdY Terms and Conditions: https://ancstry.me/2HDBym9 Rootsweb Blog: http://rootsweb.blog RootsWeb is funded and supported by Ancestry.com and our loyal RootsWeb community
On Thu, 01 Nov 2018 17:23:45 -0000, Angus Administrator via LISTOWNERS <listowners@rootsweb.com> wrote: > I scrolled down until everything had disappeared off the top of the page > and > found no additional information. I have tried right-clicking and > left-clicking on every part of the message in the hope of finding some > hidden details, but to no avail. Unfortunately finding this information varies with every email client. You need to look for something labelled as maybe view headers, view source, view raw message, message properties, message details, hopefully that will give some idea. When you find it you'll some gobbledegook that starts like: Return-path: <listname-bounces@rootsweb.com> Received: from ... And miles down (remember here that you have to srcoll past the headers of the message delivered to you into the headers of the original message that has been rejected), just before the actual body part of the message will be a header something like: X-Mailman-Rule-Hits: nonmember-moderation I have seen this appear as: X-Mailman-Rule-Hits: emergency when the main text says N/A This bothers me in that it implies that the old MM2 'Emergency Moderation' can possibly be turne on behind the scenes even thoughthe list owner has (so far, in MM3) no means of toggling emergency moderation on and off. > In any case, the problem is not what the reason for holding them is or > isn't. The problem is that the system is not doing what it is supposed > to. Wrong! The reason is *very* important, it may be for a reason that you (all we list owners) have no control options for - like acceptance of messages with the list-name suffixed '-l'. Malcolm. -- Malcolm Austen <malcolm.austen@weald.org.uk>
I am using Outlook because Outlook Express stopped working. I knew how to view headers etc in Outlook Express. I cannot see how to do so in OE. So I went into webmail and looked at that message from me to my List, not using my Admin e-mail address, and I found a thing saying 'Raw message'. This is what it produced. Start pasted text >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> X-Apparently-To: angus.admin@btinternet.com; Thu, 01 Nov 2018 12:19:08 +0000 Return-Path: <angus-bounces+angus.admin=btopenworld.com@rootsweb.com> Received-SPF: pass (domain of rootsweb.com designates 35.172.205.187 as permitted sender) X-YMailISG: gI_nDZEWLDvzhiad4henVOdMX0Ea4BOn9ehHlfWq_h.2r0ff WIi6jW7LnEuqBUo2bCWGSKNIdJgZbq.saVKc_2Q3DKu750RHLTVf1q6ZcvNK mnuNpjd10ox1Uy2Lt01T4mSQeFuxdCi6yXvbpzOoKxN1DhUN486IU22LNMz3 r2EpTNZNxXGSRskj7hWmpxNAbEf9VgCMTNMEZvdoNkPfSz8v5ifVqeHHS976 98JdaXKEqFRC8tCovdB8.zfjC5Tblxb90bTvcjyVffIQ9lJEnPXnQwf70DNj lWl4htmifilrtiEMCdwBm9k0IiAWhYqp4qOvtpJULitZbGg3bgZyikH4tsOp W3hh_O9.WzMqWWBmyQZD5tyIhN22NSaHawZloLYr1_hE5aWCa09ohKJCsDh4 Q..VLhbEHkaFmAt_PKDXoXeLlwsjX2_tQuel0g7iURrDtWQ_cepMV5y.RHMI zY5PaA7Ef4WDvM02TIdDrroXTbKx55FHTWum01.yHgg_ljOU_i9_7mkUMcTt Y_T7iIEfEQ_tDy6jpDe5XH99qyIkfVEh5SLjWJDCHpqZ_BVaHhFmyMW6qTwM okTRMyVEi6zjob5e.Fj4A3Z39VTkM82iURIAUFnh4PfaGdyVYH3sUsJiPagw _jxvPUiPy.JT9yhXiIwDgSG9WLkDb2XnRVf4iOdk9F.ovzHdEDgQ0G557ywl a_VpmKzkPHYA6sh.h4eC_hxwoILs4JCCF2DWnaTyI9sXjyAM2cs9UhvI64eg s56qEDYlL09hXBu1paQtDRxhXh68yiaVJOAsXomfg_lihpK9Ws5gWsA1ENV2 j5JLCQuTEuyV9eTkZL0ffBmZWPDsyktoOnkylZde95DFOc4jKkd9yxFbNhc_ RzFNQfiLuuRpyuhZbfnunrhkd_WJV0dX20TdYX5nMrbehPc1bcwVyyo_rDof JxDbxUIj3N9.OLRDUbVruiwt5LQUQtbkIQwCSZCRcX4aHW7WAtQu6e3tNeoI mwmOqO5CAsfC.2F85EESViZuXoWIxx_eL6XzsEohFOhvbWd0ACJfVVBq5fq8 Z5DXqKRiXpwCwEaCguVu1qcEkBkOg2RV1M0ALOMziB6MkxSCE7vYCwYgIFwy WzTgT0uPRsFXQPPDuXMDr3Gl9IeyIlQyGWwXx8L80d3aROWG5aJwhoLzAKIp 6cADJvNSQZtYtKVqU5wvBY5usHu_O2dLg81wX0Lbzh1dSRihTUNhEjq5EFeJ MjN06qqTA3v2UkkJFl3k17CxWy2tAQ-- X-Originating-IP: [35.172.205.187] Authentication-Results: mta1044.bt.mail.ir2.yahoo.com from=; domainkeys=neutral (no sig); from=rootsweb.com; dkim=pass (ok) Received: from 192.243.246.26 (EHLO rgin01.bt.ext.cpcloud.co.uk) (65.20.0.12) by mta1044.bt.mail.ir2.yahoo.com with SMTP; Thu, 01 Nov 2018 12:19:08 +0000 X-OWM-SPF-MAILFROM: Pass X-OWM-SPF: 0 X-OWM-DKIM: 1 X-OWM-DMARC: spf 0 dkim 1 X-Originating-IP: [35.172.205.187] X-OWM-Source-IP: 35.172.205.187(US) X-OWM-Env-Sender: angus-bounces+angus.admin=btopenworld.com@rootsweb.com X-RazorGate-Vade-Classification: clean X-RazorGate-Vade-Verdict: clean 15 X-VadeSecure-score: verdict=clean score=15/350, class=clean X-SNCR-VADESECURE: CLEAN X-RazorGate-Vade-Verdict: clean 15 X-RazorGate-Vade-Classification: clean X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedtkedrieehgdeflecutefuodetggdotefrodftvfcurfhr ohhfihhlvgemuceutffkvffkuffjvffgnffgvefqofenuceurghilhhouhhtmecufedttdenucgo teeftdduqddtudculdduhedmnecujfgurhepuffhvfggtgfkffhpsehmtderredttddvnecuhfhr ohhmpegrnhhguhhsqdhofihnvghrsehrohhothhsfigvsgdrtghomhenucffohhmrghinheprhho ohhtshifvggsrdgtohhmnecukfhppeefhedrudejvddrvddthedrudekjeenucfrrghrrghmpehh vghloheprhiflhhishhtshhmrghilhdrrhhoohhtshifvggsrdgtohhmpdhinhgvthepfeehrddu jedvrddvtdehrddukeejpdhmrghilhhfrhhomhepoegrnhhguhhsqdgsohhunhgtvghsodgrnhhg uhhsrdgrughmihhnpegsthhophgvnhifohhrlhgurdgtohhmsehrohhothhsfigvsgdrtghomheq pdhrtghpthhtohepoegrnhhguhhsrdgrughmihhnsegsthhinhhtvghrnhgvthdrtghomhequcfq tfevrffvpehrfhgtkedvvdenrghnghhushdrrggumhhinhessghtohhpvghnfihorhhlugdrtgho mhenucevlhhushhtvghrufhiiigvpedt Received: from rwlistsmail.rootsweb.com (35.172.205.187) by rgin01.bt.ext.cpcloud.co.uk (9.0.019.26-1) id 5BA137942A8AA565 for angus.admin@btopenworld.com; Thu, 1 Nov 2018 12:19:07 +0000 Received: from mmlive.rootsweb.com (localhost [127.0.0.1]) by rwlistsmail.rootsweb.com (Postfix) with ESMTP id 458434E0D5 for <angus.admin@btopenworld.com>; Thu, 1 Nov 2018 06:19:06 -0600 (MDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rootsweb.com; s=rw; t=1541074746; bh=6PeyLCps4hc/7BxZf2fJMDcKO8b7H/503AeFSYzT8/s=; h=Subject:From:To:Date:From; b=Z+Gu7sD2ewg7maYtAaqaJlPs+jutnAmIREkvfiSHUJoc7sm+KfA5CYsmxJIfv0MWB 8QvTql3iEr+InAz6f3ZhcKtV4+4oBUUR7CFaAK8+gc8UGJAIAACtCy2STEPGCxnzZj J0mBcMjpth5BQzeFcAX8aTOnba4ZMUprMjru2+zo= Received: from mmlive.rootsweb.com (localhost [127.0.0.1]) by rwlistsmail.rootsweb.com (Postfix) with ESMTP id E805518E51B for <angus-owner@rootsweb.com>; Thu, 1 Nov 2018 06:18:47 -0600 (MDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rootsweb.com; s=rw; t=1541074727; bh=6PeyLCps4hc/7BxZf2fJMDcKO8b7H/503AeFSYzT8/s=; h=Subject:From:To:Date:From; b=bIBz5wc0RItY19F/JQ9+W9ak833pQXMf0NDs7PS3CnMBNFq/ny87txUXiKUdIOtG4 0qw2AIkQ8vOPtfuZ0vltcRqgB1tPssuEUimde8U5dUupcgxboUeN3ra9BL4NXw8aYI aqGr7o58/dLJEFgtKs027U9LMg4MQiwdRinTAQb8= Subject: angus@rootsweb.com post from anne.genlists@btinternet.com requires approval From: angus-owner@rootsweb.com To: angus-owner@rootsweb.com MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="===============3190183839173045530==" Message-ID: <154107472615.12375.12677454501017466920@mmlive.rootsweb.com> Date: Thu, 01 Nov 2018 06:18:46 -0600 Precedence: bulk X-Mailman-Version: 3.1.0 Message-ID-Hash: W52GI6LZVGZXNY6W25IMTKMHHVTTNXIV X-Message-ID-Hash: W52GI6LZVGZXNY6W25IMTKMHHVTTNXIV X-MailFrom: angus-bounces@rootsweb.com Content-Length: 15396 --===============3190183839173045530== Content-Type: text/plain; charset="us-ascii" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit As list administrator, your authorization is requested for the following mailing list posting: List: angus@rootsweb.com From: anne.genlists@btinternet.com Subject: RE: [ANGUS] Re: Scottish marriages The message is being held because: N/A At your convenience, visit your dashboard to approve or deny the request. https://lists.rootsweb.com/postorius/lists/angus@rootsweb.com/held_messages --===============3190183839173045530== Content-Type: message/rfc822 MIME-Version: 1.0 Received: from NAM01-SN1-obe.outbound.protection.outlook.com (mail-sn1nam01lp0115.outbound.protection.outlook.com [207.46.163.115]) by rwlistsmail.rootsweb.com (Postfix) with ESMTPS id 434C418E51B for <angus@rootsweb.com>; Thu, 1 Nov 2018 06:18:45 -0600 (MDT) Received: from MWHPR1601CA0007.namprd16.prod.outlook.com (2603:10b6:300:da::17) by SN6PR16MB2656.namprd16.prod.outlook.com (2603:10b6:805:d9::11) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.1273.27; Thu, 1 Nov 2018 12:18:44 +0000 Received: from DM3NAM05FT057.eop-nam05.prod.protection.outlook.com (2a01:111:f400:7e51::206) by MWHPR1601CA0007.outlook.office365.com (2603:10b6:300:da::17) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.1294.23 via Frontend Transport; Thu, 1 Nov 2018 12:18:43 +0000 Authentication-Results: spf=softfail (sender IP is 148.163.143.216) smtp.mailfrom=btinternet.com; rootsweb.com; dkim=pass (signature was verified) header.d=btinternet.com;rootsweb.com; dmarc=pass action=none header.from=btinternet.com;compauth=pass reason=100 Received-SPF: SoftFail (protection.outlook.com: domain of transitioning btinternet.com discourages use of 148.163.143.216 as permitted sender) Received: from mx0a-002f8e01.pphosted.com (148.163.143.216) by DM3NAM05FT057.mail.protection.outlook.com (10.152.98.116) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.1318.5 via Frontend Transport; Thu, 1 Nov 2018 12:18:43 +0000 Received: from pps.filterd (m0143794.ppops.net [127.0.0.1]) by mx0b-002f8e01.pphosted.com (8.16.0.22/8.16.0.22) with SMTP id wA1CH5mu032299 for <angus@rootsweb.com>; Thu, 1 Nov 2018 06:18:42 -0600 Authentication-Results-Original: ppops.net; spf=pass smtp.mailfrom=anne.genlists@btinternet.com; dkim=pass header.d=btinternet.com header.s=btcpcloud; dmarc=pass header.from=btinternet.com Received: from rgout0804.bt.lon5.cpcloud.co.uk (rgout0804.bt.lon5.cpcloud.co.uk [65.20.0.151]) by mx0b-002f8e01.pphosted.com with ESMTP id 2nfdqdavdm-1 for <angus@rootsweb.com>; Thu, 01 Nov 2018 06:18:42 -0600 X-OWM-Source-IP: 81.158.22.117 (GB) X-OWM-Env-Sender: anne.genlists@btinternet.com X-RazorGate-Vade-Classification: clean X-RazorGate-Vade-Verdict: clean 0 X-VadeSecure-score: verdict=clean score=0/300, class=clean X-SNCR-VADESECURE: CLEAN X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedtkedrieehgdeflecutefuodetggdotefrodftvfcurfhr ohhfihhlvgemuceutffkvffkuffjvffgnffgvefqofdpqfgfvfenuceurghilhhouhhtmecufedt tdenucenucfjughrpefhvfhfjgfufffkgggtgffothesthejghdtvddtvdenucfhrhhomhepfdet nhhnvgcuuehurhhgvghsshdfuceorghnnhgvrdhgvghnlhhishhtshessghtihhnthgvrhhnvght rdgtohhmqeenucfkphepkedurdduheekrddvvddruddujeenucfrrghrrghmpehhvghlohephgfk pfffqfghuffktdgfuddulfgfpdhinhgvthepkedurdduheekrddvvddruddujedpmhgrihhlfhhr ohhmpeeorghnnhgvrdhgvghnlhhishhtshessghtihhnthgvrhhnvghtrdgtohhmqedprhgtphht thhopeeorghnghhushesrhhoohhtshifvggsrdgtohhmqeenucevlhhushhtvghrufhiiigvpedt Received: from WINDOWSI0U11JU (81.158.22.117) by rgout08.bt.lon5.cpcloud.co.uk (9.0.019.26-1) (authenticated as anne.genlists@btinternet.com) id 5BC47A8701732601 for angus@rootsweb.com; Thu, 1 Nov 2018 12:18:41 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=btinternet.com; s=btcpcloud; t=1541074722; bh=AlIq5pyHWYOTj32FieSmISxNG5N1Q0+qWmONtaflNDw=; h=From:To:References:In-Reply-To:Subject:Date:Message-ID:MIME-Version:X-Mail er; b=t35noL7qRayUsYSew/qbs+byD99Xb4DHATcblUv9eUH79IZJVvS01LxC0VMawYkjz1ecozibyH Kz1tuQVG7oE6jWi3mqAEAoN1Os3drmO7Y4ctukkMYUcX75Jvnqzz1WKC+Go5Vip3nBKq1HB1LNNA PsD65NdxGPkuLcV4WYkfk= From: "Anne Burgess" <anne.genlists@btinternet.com> To: "'ANGUS'" <angus@rootsweb.com> References: <70b317b04d264f03832532956a26863b@nationalgalleries.org> In-Reply-To: <70b317b04d264f03832532956a26863b@nationalgalleries.org> Subject: RE: [ANGUS] Re: Scottish marriages Date: Thu, 1 Nov 2018 12:18:40 -0000 Message-ID: <001f01d471dd$066d6250$134826f0$@btinternet.com> MIME-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: 7bit X-Mailer: Microsoft Outlook 15.0 Thread-Index: AQFI3xMZbTnNApStZ1/PqmVimwbgEaZR+rAw Content-Language: en-gb X-CLX-Shades: MLX X-CLX-Response: 1TFkXGxofEQpMehcbEh4RCllNF2dmchEKWUkXGnEaEBp3BhIfcRwQGncGGBo GGhEKWV4XbGx5EQpJRhdLRElPWV5YU3VCRVleT04RCkNOF0tMHUMfGhp1chMcB11mGQcdcGVlHB 5vYUVeEh1yRx1YEQpYXBcfBBoEGx8ZB05LTElOSEkSBRsaBBsbGgQeEgQSHBAbHhofGhEKXlkXf m9gZRMRCk1cFxgTGxEKTFoXe2lNa3sRCkVZF29rEQpMXxd6BQUFBQUFBQUFbxEKTEYXb2trbGtr EQpDWhccHwQYGgQaBBsfGxEKQl4XGxEKQkYXZl9SRnxMelpIG20RCkJcFxsRCl5OFxsRCkJLF2x nSRxHSEhCfGJYEQpCSRdsZ0kcR0hIQnxiWBEKQkUXYER9ZX4BHmVyGmURCkJOF2xnSRxHSEhCfG JYEQpCTBdofQVNXHBieWtETxEKQmwXbVtNfQFyGHJ4bGkRCkJAF2NCbnlFTGUBfnoSEQpCWBdvU G0ZEmEffnkTWhEKTV4XGxEKWlgXGREKcGcXa3gYTBNJHEJuGkQQGRoRCnBoF2NATkkBQUR4QmtI EBkaEQpwaBdoRnpIU0MceGtzXxAZGhEKcGgXYkYTBVAaRlJfUnIQGRoRCnBoF21jQ3xZYmkeZEQ ZEB4SEQpwaBdhUF8TaVN7bX1YbRAeEhEKcGcXY3NNBR1DWllpeB0QGRoRCnBsF29OGWtgaWxQHh 1GEB4SEQpwQxdif31ERmwTQmxfTBAZGhEKbX4XGxEKWE0XSxEg X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:,, definitions=2018-11-01_08:,, signatures=0 X-Proofpoint-Spam-Details: rule=inbound_notspam policy=inbound score=0 priorityscore=184 malwarescore=0 suspectscore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=105 lowpriorityscore=0 mlxscore=0 impostorscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-1807170000 definitions=main-1811010109 X-EOPAttributedMessage: 0 X-EOPTenantAttributedMessage: fcf82d21-fd42-46be-a4f5-537daf908555:0 X-Forefront-Antispam-Report: CIP:148.163.143.216;IPV:CAL;SCL:-1;CTRY:US;EFV:NLI;SFV:SKN;SFS:;DIR:INB;SFP: ;SCL:-1;SRVR:SN6PR16MB2656;H:mx0a-002f8e01.pphosted.com;FPR:;SPF:None;LANG:e n; X-Microsoft-Exchange-Diagnostics: 1;DM3NAM05FT057;1:XJSKXq0fispO9ECZu0wrj9aOQC/7B3GY0IkGKNZjiWaHTpKRwpDKnuHXgl 7qaN8XEfcRKa4kiu85vd8dEAvzOss3a17ic7rkSDKQoe7WH2Hu+jfomG6cagJj8aw9sjGW X-MS-PublicTrafficType: Email X-MS-Office365-Filtering-Correlation-Id: b0b160b7-39e3-4f73-58d6-08d63ff42a71 X-Microsoft-Antispam: BCL:0;PCL:0;RULEID:(7020095)(4652040)(5600074)(711020)(4605076)(4608076)(140 1271)(8001031)(1421009)(1402068)(71702078);SRVR:SN6PR16MB2656; X-Microsoft-Exchange-Diagnostics: 1;SN6PR16MB2656;3:wgo7KdAD82Ml+SboWUagkBD+HHJUrtJ2QoCH+pZV2gCue7EI5lxHySfGGr 6XmYN9QWNILYvFhKPAAYnPXaTATNAkN2AYdzTg0L9TQhcjSNv/3+tjhawAWvoypUlWaSu3DV7WtL h8oaR9gTLkTewCkzJSAVGl5bdc2BbzGpRDLbeKgBFKusHkqbyez9WcJyy3u6Ehybi7qfNk+qP7AF 3YCoVVpEobs7HOjUXJ3GfeavJJOirjdUket/69YRZiyst5LJfk6PXhr/gVtQunFmziLNQh91Jwm1 +/R+DDz1VE3vQBkOi1fjpGt6JZMgJ+1swDDf+3tUgF0vznYrCWxpzVB0nsoociIQ5E+4AuRqKN9h 4=;25:axmD7KP9904nnsNWO+GquEHgaj3akwsMkwZmHVbI3Y1iq8CI6kLaLkdVxaw8BiTpvwechb tR5SbU7aKSz2wxOFw3sy3TNU3An+ekGX3pZE8FaMN1fBE6r3Cq1S4zQpeW62capsYJZDcDKmPlMP 24AKMhNfUF98sXH5kqVq0aPZjScapoSeH/56xFeXSDeaTSDIzPLKhEBDPQv+P1ROjimzAU0vpVGe bBvhyoXfcTm54zB8Rua92nAAEH3MdMik6TtcR7o2wmsRDg94fKIT3jWVJeWHKP6oJr7ypnnwivW7 aHPBy4xwqMyOYnGGFVwtLXoI5BrvPEMDBL+1rcfvEOCQ== X-MS-TrafficTypeDiagnostic: SN6PR16MB2656: X-Microsoft-Exchange-Diagnostics: 1;SN6PR16MB2656;31:jyv/lb6OQc+pw4LdY5v/2pBZqpYpdOSmhDodGMNZRjBPzhJCxbpAIKwYU 8hS8S5orVbgYb2NWGFe8pymWicI2d5iMZAF9ZNwmczVTKYhspcnDPUmxlC4JPk0HQxxiRf+YoxRU +GqVVqw9jYrqPA1jZvgVzifWF8IFkmxa2PCvp2yX41it6zloZD8dWEvCi4xPOXMVejL7TqL4oEFF q+guPd26N7uZL4gCgqbSIJfeNM=;20:NTy7FHXXaY4TKI6uTyOh4CXsNHxd45Ni+tERqjQj/svcg tq8YrFVYxLfiJMcNKaRUjSHx0eF8DrSxEndaWwLWVerhx/6H3ixK2QGhCKyXlAk4P2vvQHALnlf1 tlagO2EXac+okjs5zH4Dvqlx1y0uV6562NRG9x1VXQK7gFJaeX60E9sm/wsLpLcTdFsJMzMvQnYW M8qpAEiPYf2Q/A6h3B89mWbJOCHFpZWJQp2E3zCi0H2tSbqU5MI3N9NHIZg74nKny3BMZJHin3cA h7a0KWmC97zFYHis7TbaMznx31nkZRtCmiQiYfIOGQVpm7gPck1MYWUnHyhXSiVjk1TSsb9HLseG QiwuLJ2RIvuGHfVMuoXwUJjD/wTCieeKKO2P4pVxGzRlx70NyZRWlFfeyA7gKSLX0H2qpP4LBpxN nVk5ak/S2zkNrkKjv7lH9pUD16p/2tKK+/qPf55lxSMwDNlh5m24KWYfpVs525MJGn+kmq6MER2b vJc7loOJGnVV5+zQNMmaGj2lsrIxX9m97KZiOfzmWNLCj0QugF+NFwEecjMZsNSPbWfhApn5yORt kmKvRKCUZJrplumFHxo4AQAE3qH/hGafWpQVVMbyD0= X-Exchange-Antispam-Report-Test: UriScan:; X-Exchange-Antispam-Report-CFA-Test: BCL:0;PCL:0;RULEID:(2018062399030)(2018011200283)(2401047)(8121501046)(52410 047)(2018011210174)(2018011211064)(2018011212028)(2018011213028)(20180112140 28)(2018011215028)(2018011216028)(2018011217028)(2018011218028)(201801121909 2)(2018011220252)(2018011221063)(2018011222027)(2018011223027)(2018011224027 )(2018011225035)(2018011229035)(2018011232269)(2018011233052)(2018021202149) (98810176)(2018021203149)(98815176)(1430482)(1431068)(1432130)(1459057)(1630 038)(823300264)(823350442)(823411253)(9101536074)(3231382)(901025)(902075)(9 13088)(7045084)(944500087)(944510158)(944921075)(946801078)(946901078)(93000 00249)(9301000214)(52103095)(52104123)(52105095)(52106170)(52408095)(9882102 7)(98822027)(52401380)(52601095)(52505095)(52406095)(52305095)(52206095)(888 60288)(1102011)(93006095)(93005095)(10201501046)(3002001)(1610001)(830100107 5)(8301003183)(148016)(201708071742011)(7699051)(76991095);SRVR:SN6PR16MB265 6;BCL:0;PCL:0;RULEID:;SRVR:SN6PR16MB2656; X-Microsoft-Exchange-Diagnostics: 1;SN6PR16MB2656;4:NmNNUQSxOqcoWNh6RIkWVyRaVINlb8xBo+uK9TUkDhvpqVPY7Scs3Fr8l0 0+VBqR2L3Aejyz+zvTeIXKlGPwKae4uOs7xs1zacWv6C8RZbV1ar32QVCadfSppQluRkqEnanhHo eDvWsiw8LehX1AYKmQlHHkDh8EvtKKR9iYbu7NHE6Ih7gSxGgW9XnJoPElGHrLe2lEc8z24nRojt ABz5K09awIG1yyXTo8hxUphgKb7pl6jR8dOoqZJTYKL72PaJAfLjRRL6NAhkFtqnm2OQ==;23:jb o1Yq1yR4YGyfV5h47Bu3o9oChuTC3ZUREvoCL9TpfpzgKF8P3KthzIPHG3qWOmOSaft4w3ZuvB1Q edCtY9ogf8mi/tlmLw0tBe5fYXdFYUcEZm6Pfpf6tzg+BnGQDPk/MoQElRBDvC03RcBSUYpiGVoX PcRs/1NJJtsmeORADhK6q/oMt8GNbzwlFY3BqH X-Microsoft-Antispam-Message-Info: =?us-ascii?Q?efIXb+2D37/sNB1teSJXAI9gYEtbR1PVDIM9wWVj0teAkZv2kciH7eCHzD3A?= =?us-ascii?Q?cR+7VwNLqTQM+aDrsLzMKuGNRWY5aDQukXhTTYaH/b/RHgt2oJAWommrHzb5?= =?us-ascii?Q?AjYeYxDophef1KQ2NPX34H4gDXkqcvsWX4WwWnTrfYxaJlXZeEkSlInCyKvK?= =?us-ascii?Q?4F3EPgF740/jHg+Ib36KCpIafM6/vhVLKEJS27WXPFwnss4oulPm7RixCxZU?= =?us-ascii?Q?U2lZfWPYlItSvTnj/LLt9FTnMqg5Ujzs433Qzxs/sonWx9WCkWDoKxwPSMcv?= =?us-ascii?Q?NCUBwG5I+vAKKSRjR3xo5SRE1GMxVTY0poT9qiUoHSZYzqVOVZrXK7rtiXfK?= =?us-ascii?Q?CVRXfKG9dOKMzA0q1gUTe6WOXcNyZPGKyWYiH22ZITyvekpGlZTZ/hLEqYIu?= =?us-ascii?Q?b4wlEhS0nv2wMolq9RLcW6g82QF27vEsaCyOSKSKJs93XpiPDt2jSj++z9A0?= =?us-ascii?Q?ePcGC3UW4RMxKqEwzxORIkEWXh9bUl+5ttZGg2vkbhYPnqrp4wByiwzO28HZ?= =?us-ascii?Q?VjI/7IoDXrnK/rl2LWokS9xM6bsGjQOKUPXHHj9maMTq/V9gNmP9tD6zm+Ot?= =?us-ascii?Q?OkSa6ukx2mbM0Cd9nowEP8px/+/k3ouFXWCpvogMcNC6OMTTMEiriy2ASuXE?= =?us-ascii?Q?qJO3HtBGWeJYVRVZoGwCcnOhyHmBqMPYu74HOdSd//JuKwZAHnk3VccZnziY?= =?us-ascii?Q?ZTIfYBvfpkZpAqlCSQVlnDBQd6ZYU7VrQv98u78fKM5LNmna+lbUTQluKd9s?= =?us-ascii?Q?YfOZXmgIs/l8TfuyrBltY0tRjBzpy+gRQCBZ+dIECFZcYC5NnbIhGbsJGMam?= =?us-ascii?Q?Vih2K1N1dVl5FcLo7V4d4H6PCgKlnH3wcYnQk6L0MMH83Cxzd8t8AHrfor2V?= =?us-ascii?Q?FOcNhpHLeihIVSApsxEVpWZA43bAP8wzZfJx6U7d8N3DbcM9eXMHj/qBcbMq?= =?us-ascii?Q?IS2Kzhihgas5jp/c+SlQNgN465z0tbvpPnbQlvAwOpEvhc77IRU7lZQMsjA8?= =?us-ascii?Q?PZDTs7O4EeoM1TgLas3gE3ntW54eI0Dln5PDOxO1ie/il++v5ioV/war2UBs?= =?us-ascii?Q?wUfauoiz2j7BDxkef0NJ0ichyUxAPMu5G0WK1ut5MZMkTQ1SlGmyTa8dSDmG?= =?us-ascii?Q?g7iMI4xf+MgelUHY41GiVFJf+TSNfaxAtA=3D=3D?= X-Microsoft-Exchange-Diagnostics: 1;SN6PR16MB2656;6:t35mzKe1sr9UTKAtWs2nIVDfJXcvVckkT0NR0NasXhue48gJueGXx7CmbJ y+p3tPgBjFAFwUWTtQPqwG4ANYJ8PirsCX1lMcrSUz1nhyht1yVI9hZJbyOMvie90wxYNKnIE4Mb I7pYaqDcBRlGtAcgG2lk5z8mdlHPe77x9aw1C3L+gYM2qcnOsrh2Se0URMj01nFZaBO/Lq7cI9C2 NrqjP24OWqNcD/2aPd6h8gRt+utHHMFZqGa3bEMTlPrvggAqsALrSRnC59qLq4xGzfbcRureypcK JV2yG72LfIZhN+v502FA/tcr/Q/FaW6EcVeS8Bl0Lo23Ccdy+Nav3yDyB86Duv2Y47lNXs6LPej7 YkP87MJdeiDpZRs5FPgcKnQ7nQMXZmw5SNjE7kqEcpcawe9LLR5ZZ4lPoJPu7GNZ3tPd8qWrpCGC eoZkEnPDPFB9WRZqRfS/XEJDNS30KhdQ==;5:RuvCq11nlmBVbtmfid7uO9OnF+B9qliCi6JAi6g hwG03G4AHD5rxxetBBR1mvwY62zoczO6vacajIGBl/AP81cGQOcrc8upZu/vj6JqxrG3aUsPskaY 0i3v31baRKEJ4zvs1OH1yq229wqL5/65tF4eW/lSJqi5wTp6kvFhCzBY=;7:xQ5J4lYgpJqecSER 0UKm3dWHkvIaGgDxBlNiOQfsYglVocXTmoJXKy2RsW7h0JH+jGkSaNzb5/ipahvysiBLvtaS5FSx afqnrXgpsS2GNva3j8uSzFg75VW289nLvKphIxV63Q0wnK5voinsimgANw== SpamDiagnosticOutput: 1:2 SpamDiagnosticMetadata: 2d759f38b14c4a58b51c255017c5f971 X-OriginatorOrg: ancestryonline.onmicrosoft.com X-MS-Exchange-CrossTenant-OriginalArrivalTime: 01 Nov 2018 12:18:43.3801 (UTC) X-MS-Exchange-CrossTenant-Network-Message-Id: b0b160b7-39e3-4f73-58d6-08d63ff42a71 X-MS-Exchange-CrossTenant-Id: fcf82d21-fd42-46be-a4f5-537daf908555 X-MS-Exchange-CrossTenant-FromEntityHeader: Internet X-MS-Exchange-Transport-CrossTenantHeadersStamped: SN6PR16MB2656 X-MS-Exchange-CrossPremises-OriginalClientIPAddress: 148.163.143.216 X-MS-Exchange-CrossPremises-SCL: -1 X-MS-Exchange-CrossPremises-AuthSource: DM3NAM05FT057.eop-nam05.prod.protection.outlook.com X-MS-Exchange-CrossPremises-AuthAs: Anonymous X-MS-Exchange-CrossPremises-TransportTrafficType: Email X-MS-Exchange-CrossPremises-TransportTrafficSubType: X-MS-Exchange-CrossPremises-Antispam-ScanContext: DIR:Incoming;SFV:SKN;SKIP:0; X-MS-Exchange-CrossPremises-Processed-By-Journaling: Journal Agent X-OrganizationHeadersPreserved: SN6PR16MB2656.namprd16.prod.outlook.com X-MailFrom: anne.genlists@btinternet.com X-Mailman-Rule-Hits: emergency X-Mailman-Rule-Misses: dmarc-mitigation; approved Message-ID-Hash: 43JK3STA27QVI4HKDHIBOLPB2HPKMDKA X-Message-ID-Hash: 43JK3STA27QVI4HKDHIBOLPB2HPKMDKA Yes, I always make a point of looking up both records for that very reason. One soon gets to know which of one's parishes have better records than others. :) I bet you wish it had been 'The' Captain Kidd! Anne -----Original Message----- From: Sheila Perry [mailto:sperry@nationalgalleries.org] Sent: 01 November 2018 08:34 To: 'angus@rootsweb.com' <angus@rootsweb.com> Subject: [ANGUS] Re: Scottish marriages Hello, I don't think I have an example of the double recording of marriages in Angus, but for one couple in Fife in the late 18th century I found a marriage recorded separately in Elie and in Kilconquhar, and the level of detail was quite different in each case, so I would say it's really important to look at both entries if this occurs. In one of my two parishes (I think it was Elie but it's a while since I looked at this) there was just a basic entry with the date and the names of the couple themselves, and no mention of where either of them lived or were from, but in the other case it mentioned that the bride was of the parish, but the groom was from the parish of Loth, in the diocese of Dornoch, in the county of Sutherland, which was in fact quite a surprise to me. It also gave his occupation and the name of his employer (Captain Kidd, who turned out not to be the notorious pirate but the retired captain of a customs ship). Best wishes, Sheila --===============3190183839173045530==-- End pasted text <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< It says in the middle of that lot that 'Message is being held because N/A' but that's the bit that actually appears in the notification. I have no idea how to interpret the rest of the gobbledegook. I have just about had it with this new List software and am seriously considering resigning because the new system does not do what the old system used to do seamlessly, I am obviously not up to the task of doing all these new administrative tasks that I should not need to do in the first place, and I have better things to do with my time in the few years of life left to me. Anne -----Original Message----- From: Malcolm Austen [mailto:malcolm.austen@weald.org.uk] Sent: 01 November 2018 17:43 To: Listowners list for Rootsweb list admins and moderators <listowners@rootsweb.com> Subject: [LO] Re: Subscriber messages are still being held for approval On Thu, 01 Nov 2018 17:23:45 -0000, Angus Administrator via LISTOWNERS <listowners@rootsweb.com> wrote: > I scrolled down until everything had disappeared off the top of the page > and > found no additional information. I have tried right-clicking and > left-clicking on every part of the message in the hope of finding some > hidden details, but to no avail. Unfortunately finding this information varies with every email client. You need to look for something labelled as maybe view headers, view source, view raw message, message properties, message details, hopefully that will give some idea. When you find it you'll some gobbledegook that starts like: Return-path: <listname-bounces@rootsweb.com> Received: from ... And miles down (remember here that you have to srcoll past the headers of the message delivered to you into the headers of the original message that has been rejected), just before the actual body part of the message will be a header something like: X-Mailman-Rule-Hits: nonmember-moderation I have seen this appear as: X-Mailman-Rule-Hits: emergency when the main text says N/A This bothers me in that it implies that the old MM2 'Emergency Moderation' can possibly be turne on behind the scenes even thoughthe list owner has (so far, in MM3) no means of toggling emergency moderation on and off. > In any case, the problem is not what the reason for holding them is or > isn't. The problem is that the system is not doing what it is supposed > to. Wrong! The reason is *very* important, it may be for a reason that you (all we list owners) have no control options for - like acceptance of messages with the list-name suffixed '-l'. Malcolm. -- Malcolm Austen <malcolm.austen@weald.org.uk> _______________________________________________ Email preferences: http://bit.ly/rootswebpref Unsubscribe https://lists.rootsweb.com/postorius/lists/listowners@rootsweb.com Privacy Statement: https://ancstry.me/2JWBOdY Terms and Conditions: https://ancstry.me/2HDBym9 Rootsweb Blog: http://rootsweb.blog RootsWeb is funded and supported by Ancestry.com and our loyal RootsWeb community
On Thu, 01 Nov 2018 18:20:05 -0000, Angus Administrator via LISTOWNERS <listowners@rootsweb.com> wrote: > I am using Outlook because Outlook Express stopped working. I knew how to > view headers etc in Outlook Express. I cannot see how to do so in OE. > So I went into webmail and looked at that message from me to my List, not > using my Admin e-mail address, and I found a thing saying 'Raw message'. > This is what it produced. > Start pasted text And lo, way down there it says: X-Mailman-Rule-Hits: emergency So you probably need Anne to find the hidden switch to take your list off emergency moderation. Malcolm. -- Malcolm Austen <malcolm.austen@weald.org.uk>
Thank you. I have forwarded that to Anne Mitchell Anne -----Original Message----- From: Malcolm Austen [mailto:malcolm.austen@weald.org.uk] Sent: 01 November 2018 18:34 To: Listowners list for Rootsweb list admins and moderators <listowners@rootsweb.com> Subject: [LO] Re: Subscriber messages are still being held for approval On Thu, 01 Nov 2018 18:20:05 -0000, Angus Administrator via LISTOWNERS <listowners@rootsweb.com> wrote: > I am using Outlook because Outlook Express stopped working. I knew how to > view headers etc in Outlook Express. I cannot see how to do so in OE. > So I went into webmail and looked at that message from me to my List, not > using my Admin e-mail address, and I found a thing saying 'Raw message'. > This is what it produced. > Start pasted text And lo, way down there it says: X-Mailman-Rule-Hits: emergency So you probably need Anne to find the hidden switch to take your list off emergency moderation. Malcolm. -- Malcolm Austen <malcolm.austen@weald.org.uk> _______________________________________________ Email preferences: http://bit.ly/rootswebpref Unsubscribe https://lists.rootsweb.com/postorius/lists/listowners@rootsweb.com Privacy Statement: https://ancstry.me/2JWBOdY Terms and Conditions: https://ancstry.me/2HDBym9 Rootsweb Blog: http://rootsweb.blog RootsWeb is funded and supported by Ancestry.com and our loyal RootsWeb community
On Thu, 01 Nov 2018 18:20:05 -0000, Angus Administrator via LISTOWNERS <listowners@rootsweb.com> wrote: > It says in the middle of that lot that 'Message is being held because > N/A' > but that's the bit that actually appears in the notification. I have no > idea > how to interpret the rest of the gobbledegook. Neither should you need to know how to interpret it Anne. > I have just about had it with this new List software and am seriously > considering resigning because the new system does not do what the old > system > used to do seamlessly, I am obviously not up to the task of doing all > these > new administrative tasks that I should not need to do in the first place, > and I have better things to do with my time in the few years of life > left to > me. I have every sympathy with you there Anne. It seems to me (after 40 years in IT Support) that MM3 (or rather the postorious web interface) has been pressed into service before it is actually ready for the job. I do believe MM3 itself is fine for sysadmin usage where the list admin has access to the command line on the server. However, the postorius web interface just has too many missing button and boxes. Thst is *not* a criticism of postorious itself, just of rolling it out before it's ready for the usage in hand. but that's only my twopennyworth, Malcolm. -- Malcolm Austen <malcolm.austen@weald.org.uk>
The X-Mailman-Rule-Hits: emergency issue has been resolved. Anne On Thu, Nov 1, 2018 at 10:43 AM Malcolm Austen <malcolm.austen@weald.org.uk> wrote: > On Thu, 01 Nov 2018 17:23:45 -0000, Angus Administrator via LISTOWNERS > <listowners@rootsweb.com> wrote: > > > I scrolled down until everything had disappeared off the top of the > page > > and > > found no additional information. I have tried right-clicking and > > left-clicking on every part of the message in the hope of finding some > > hidden details, but to no avail. > > Unfortunately finding this information varies with every email client. > You > need to look for something labelled as maybe view headers, view source, > view raw message, message properties, message details, hopefully that > will > give some idea. > > When you find it you'll some gobbledegook that starts like: > > Return-path: <listname-bounces@rootsweb.com> > Received: from ... > > And miles down (remember here that you have to srcoll past the headers of > the message delivered to you into the headers of the original message > that > has been rejected), just before the actual body part of the message will > be a header something like: > > X-Mailman-Rule-Hits: nonmember-moderation > > I have seen this appear as: > > X-Mailman-Rule-Hits: emergency > > when the main text says N/A > > This bothers me in that it implies that the old MM2 'Emergency > Moderation' > can possibly be turne on behind the scenes even thoughthe list owner has > (so far, in MM3) no means of toggling emergency moderation on and off. > > > In any case, the problem is not what the reason for holding them is or > > isn't. The problem is that the system is not doing what it is supposed > > to. > > Wrong! The reason is *very* important, it may be for a reason that you > (all we list owners) have no control options for - like acceptance of > messages with the list-name suffixed '-l'. > > Malcolm. > > -- > Malcolm Austen <malcolm.austen@weald.org.uk> > > _______________________________________________ > Email preferences: http://bit.ly/rootswebpref > Unsubscribe > https://lists.rootsweb.com/postorius/lists/listowners@rootsweb.com > Privacy Statement: https://ancstry.me/2JWBOdY Terms and Conditions: > https://ancstry.me/2HDBym9 > Rootsweb Blog: http://rootsweb.blog > RootsWeb is funded and supported by Ancestry.com and our loyal RootsWeb > community >
Anne, Just a side (but related note), but how about removing all of the "gatewayed" posts still coming to us from the message boards? I mean, the only purpose for them is something for volunteers to have to manually delete per your instructions. I would personally LOVE to have a functioning gateway back instead, but that seems to be not an option. ☹ David E. Cann decann@infionline.net -----Original Message----- From: Anne Mitchell <annerootsweb@gmail.com> Sent: Friday, November 2, 2018 11:19 AM To: Listowners list for Rootsweb list admins and moderators <listowners@rootsweb.com> Subject: [LO] Re: Subscriber messages are still being held for approval The X-Mailman-Rule-Hits: emergency issue has been resolved. Anne
I thought those had been stopped. I have not seen any in the past week. Please forward the one you received to me. -----Original Message----- From: David E. Cann <decann@infionline.net> Sent: Friday, November 2, 2018 8:52 AM To: 'Listowners list for Rootsweb list admins and moderators' <listowners@rootsweb.com> Cc: RW Mailing Lists <rwmailinglists@ancestry.com> Subject: RE: [LO] Re: Subscriber messages are still being held for approval Anne, Just a side (but related note), but how about removing all of the "gatewayed" posts still coming to us from the message boards? I mean, the only purpose for them is something for volunteers to have to manually delete per your instructions. I would personally LOVE to have a functioning gateway back instead, but that seems to be not an option. ☹ David E. Cann decann@infionline.net -----Original Message----- From: Anne Mitchell <annerootsweb@gmail.com> Sent: Friday, November 2, 2018 11:19 AM To: Listowners list for Rootsweb list admins and moderators <listowners@rootsweb.com> Subject: [LO] Re: Subscriber messages are still being held for approval The X-Mailman-Rule-Hits: emergency issue has been resolved. Anne